PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_019509
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family BES1
Protein Properties Length: 313aa    MW: 34385.5 Da    PI: 9.2403
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_019509genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822202.41.3e-62101551142
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl....eeaeaagssasaspessl 94 
                  gg++rkp+w+ErEnn+rRERrRRaiaakiy GLRaq+n+ lpk++DnneVlkALc++AGwvve+DGttyrkgs+pl     + +   +s++++p+ss 
  DCAR_019509  10 GGGRRKPSWRERENNRRRERRRRAIAAKIYGGLRAQANFDLPKHCDNNEVLKALCAQAGWVVEPDGTTYRKGSRPLhidiGAIDLEANSTNTTPCSSR 107
                  689************************************************************************9887778899999********** PP

       DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasaasllpvlsv 142
                    s+ ss+++spv+sy+++p+sss+psps+ld ++++++ s+++ + +
  DCAR_019509 108 RPSPPSSSFPSPVPSYQPTPSSSSYPSPSRLDANTSSNPFSFMHQSYN 155
                  **********************************99877444444333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.9E-5811148IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MNWEEGTSCG GGRRKPSWRE RENNRRRERR RRAIAAKIYG GLRAQANFDL PKHCDNNEVL  60
KALCAQAGWV VEPDGTTYRK GSRPLHIDIG AIDLEANSTN TTPCSSRRPS PPSSSFPSPV  120
PSYQPTPSSS SYPSPSRLDA NTSSNPFSFM HQSYNSSLRP LRISNSAPVT PPLSPPITNI  180
SMQNFNWESI AKQSASLKFP FLAASCPASP TRGQRFTPVT IPECDESDST IDSGQWINFQ  240
AYAPTIGPTS PTFNLVKPVA PNVSFKNTIL EKRKGKDFEF ESISVKAWEG ERIHEVGLDD  300
LELTLGLGST KI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11231RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-125PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3072e-91BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A068UH771e-115A0A068UH77_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-115(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.68e-74BES1 family protein